PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400006253
Common NameLOC102582136
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family ZF-HD
Protein Properties Length: 303aa    MW: 34295 Da    PI: 8.3133
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400006253genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer1024.1e-3299154460
           ZF-HD_dimer   4 vrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreveee 60 
                           vrYkeClkNhAa++Gg++ DGCgEfmps gee t++ lkCaAC+CHRnFHR+e+e+e
  PGSC0003DMP400006253  99 VRYKECLKNHAANMGGYVRDGCGEFMPS-GEEETPEYLKCAACDCHRNFHRKETEDE 154
                           89*************************9.8888********************9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF047707.8E-3099151IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
ProDomPD1257742.0E-2099152IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015664.3E-29100150IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152325.239101150IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Gene3DG3DSA:1.10.10.602.4E-29233300IPR009057Homeodomain-like
SuperFamilySSF466891.38E-18234299IPR009057Homeodomain-like
TIGRFAMsTIGR015653.4E-26238295IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 303 aa     Download sequence    Send to blast
MEHRGQEKDM GLPNPNPTSY NPSHLNQQES SSSAANKFLT APIASNIPNR TTNEQNIHEN  60
TIFSPNQTLD QHNLTQNSDP DPVRQLSTSS ASERNITPVR YKECLKNHAA NMGGYVRDGC  120
GEFMPSGEEE TPEYLKCAAC DCHRNFHRKE TEDESQTPGV HRNNHRILNQ TPPSLPAVPT  180
QQQHHHKYSH SYPRGHMAPV MMSFGGNTGV AAESSSEDLN MFHGGQGIIQ PCNFSASKKR  240
FRTKFSQQQK DRMLEFAEKL GWRIQKQDEQ EVHQFCNEVG VKRQVFKVWM HNSKQATKKK  300
QT*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A2e-222392941873ZF-HD homeobox family protein
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00268DAPTransfer from AT2G18350Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006340630.10.0PREDICTED: zinc-finger homeodomain protein 6-like
SwissprotQ9ZPW72e-66ZHD6_ARATH; Zinc-finger homeodomain protein 6
TrEMBLM0ZVH10.0M0ZVH1_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000090330.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA51824128
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G18350.11e-67homeobox protein 24
Publications ? help Back to Top
  1. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95
    [PMID:21743474]